OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HDHD1A (PUDP) (NM_012080) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP304419
Recombinant protein of human haloacid dehalogenase-like hydrolase domain containing 1A (HDHD1A), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA502555 HDHD1 mouse monoclonal antibody, clone OTI7A2 (formerly 7A2) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "HDHD1A or NM_012080"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC204419 protein sequence
Red=Cloning site Green=Tags(s)

MDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMSKEELVEESQTKLKE
VFPTAALMPGAEKLIIHLRKHGIPFALATSSRSASFDMKTSRHKEFFSLFSHIVLGDDPEVQHGKPDPDI
FLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGL
PSYE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 23.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_036212
Locus ID 8226
UniProt ID Q08623
Cytogenetics Xp22.31
RefSeq Size 2155
RefSeq ORF 642
Synonyms DXF68S1E; FAM16AX; GS1; HDHD1; HDHD1A
Summary This gene encodes a member of the haloacid dehalogenase-like (HAD) hydrolase superfamily. The encoded protein has no known biological function. This gene has a pseudogene on chromosome 1. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. provided by RefSeq, Jul 2010
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HDHD1A" proteins (5)
SKU Description Size Price
PH304419 HDHD1A MS Standard C13 and N15-labeled recombinant protein (NP_036212) 10 ug
$3,360.00
LC415984 Lyophilized HDHD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432645 Lyophilized HDHD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415984 Transient overexpression lysate of haloacid dehalogenase-like hydrolase domain containing 1A (HDHD1A), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY432645 Transient overexpression lysate of haloacid dehalogenase-like hydrolase domain containing 1 (HDHD1), transcript variant 4 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products