HDHD1A (PUDP) (NM_012080) Human Mass Spec Standard

SKU
PH304419
HDHD1A MS Standard C13 and N15-labeled recombinant protein (NP_036212)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204419]
Predicted MW 23.8 kDa
Protein Sequence
Protein Sequence
>RC204419 protein sequence
Red=Cloning site Green=Tags(s)

MDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMSKEELVEESQTKLKE
VFPTAALMPGAEKLIIHLRKHGIPFALATSSRSASFDMKTSRHKEFFSLFSHIVLGDDPEVQHGKPDPDI
FLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGL
PSYE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036212
RefSeq Size 2155
RefSeq ORF 642
Synonyms DXF68S1E; FAM16AX; GS1; HDHD1; HDHD1A
Locus ID 8226
UniProt ID Q08623
Cytogenetics Xp22.31
Summary This gene encodes a member of the haloacid dehalogenase-like (HAD) hydrolase superfamily. The encoded protein has no known biological function. This gene has a pseudogene on chromosome 1. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2010]
Write Your Own Review
You're reviewing:HDHD1A (PUDP) (NM_012080) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415984 HDHD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432645 HDHD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415984 Transient overexpression lysate of haloacid dehalogenase-like hydrolase domain containing 1A (HDHD1A), transcript variant 2 100 ug
$436.00
LY432645 Transient overexpression lysate of haloacid dehalogenase-like hydrolase domain containing 1 (HDHD1), transcript variant 4 100 ug
$436.00
TP304419 Recombinant protein of human haloacid dehalogenase-like hydrolase domain containing 1A (HDHD1A), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.