HDHD1A (PUDP) (NM_012080) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC204419] |
Predicted MW | 23.8 kDa |
Protein Sequence |
Protein Sequence
>RC204419 protein sequence
Red=Cloning site Green=Tags(s) MDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMSKEELVEESQTKLKE VFPTAALMPGAEKLIIHLRKHGIPFALATSSRSASFDMKTSRHKEFFSLFSHIVLGDDPEVQHGKPDPDI FLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGL PSYE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_036212 |
RefSeq Size | 2155 |
RefSeq ORF | 642 |
Synonyms | DXF68S1E; FAM16AX; GS1; HDHD1; HDHD1A |
Locus ID | 8226 |
UniProt ID | Q08623 |
Cytogenetics | Xp22.31 |
Summary | This gene encodes a member of the haloacid dehalogenase-like (HAD) hydrolase superfamily. The encoded protein has no known biological function. This gene has a pseudogene on chromosome 1. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2010] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC415984 | HDHD1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC432645 | HDHD1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY415984 | Transient overexpression lysate of haloacid dehalogenase-like hydrolase domain containing 1A (HDHD1A), transcript variant 2 | 100 ug |
$436.00
|
|
LY432645 | Transient overexpression lysate of haloacid dehalogenase-like hydrolase domain containing 1 (HDHD1), transcript variant 4 | 100 ug |
$436.00
|
|
TP304419 | Recombinant protein of human haloacid dehalogenase-like hydrolase domain containing 1A (HDHD1A), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.