CD27 (NM_001242) Human Recombinant Protein

SKU
TP304252
Recombinant protein of human CD27 molecule (CD27), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC204252 protein sequence
Red=Cloning site Green=Tags(s)

MARPHPWWLCVLGTLVGLSATPAPKSCPERHYWAQGKLCCQMCEPGTFLVKDCDQHRKAAQCDPCIPGVS
FSPDHHTRPHCESCRHCNSGLLVRNCTITANAECACRNGWQCRDKECTECDPLPNPSLTARSSQALSPHP
QPTHLPYVSEMLEARTAGHMQTLADFRQLPARTLSTHWPPQRSLCSSDFIRILVIFSGMFLVFTLAGALF
LHQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 26.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001233
Locus ID 939
UniProt ID P26842
Cytogenetics 12p13.31
RefSeq Size 1320
RefSeq ORF 780
Synonyms S152; S152. LPFS2; T14; TNFRSF7; Tp55
Summary The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is required for generation and long-term maintenance of T cell immunity. It binds to ligand CD70, and plays a key role in regulating B-cell activation and immunoglobulin synthesis. This receptor transduces signals that lead to the activation of NF-kappaB and MAPK8/JNK. Adaptor proteins TRAF2 and TRAF5 have been shown to mediate the signaling process of this receptor. CD27-binding protein (SIVA), a proapoptotic protein, can bind to this receptor and is thought to play an important role in the apoptosis induced by this receptor. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction
Write Your Own Review
You're reviewing:CD27 (NM_001242) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH304252 CD27 MS Standard C13 and N15-labeled recombinant protein (NP_001233) 10 ug
$3,255.00
LC400496 CD27 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400496 Transient overexpression lysate of CD27 molecule (CD27) 100 ug
$436.00
TP700286 Purified recombinant protein of human CD27 molecule (CD27), with C-terminal DDK/His tag, expressed in human cells, 20 µg 20 ug
$867.00
TP723936 Human CD27 Protein, mFc-His Tag 100 ug
$595.00
TP724010 Human CD27 Protein, hFc Tag 100 ug
$595.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.