EFEMP1 (NM_001039349) Human Recombinant Protein

SKU
TP304090
Recombinant protein of human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC204090 protein sequence
Red=Cloning site Green=Tags(s)

MLKALFLTMLTLALVKSQDTEETITYTQCTDGYEWDPVRQQCKDIDECDIVPDACKGGMKCVNHYGGYLC
LPKTAQIIVNNEQPQQETQPAEGTSGATTGVVAASSMATSGVLPGGGFVASAAAVAGPEMQTGRNNFVIR
RNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTAGTHNCRADQVCINLRGSFACQCPPGYQKRGE
QCVDIDECTIPPYCHQRCVNTPGSFYCQCSPGFQLAANNYTCVDINECDASNQCAQQCYNILGSFICQCN
QGYELSSDRLNCEDIDECRTSSYLCQYQCVNEPGKFSCMCPQGYQVVRSRTCQDINECETTNECREDEMC
WNYHGGFRCYPRNPCQDPYILTPENRCVCPVSNAMCRELPQSIVYKYMSIRSDRSVPSDIFQIQATTIYA
NTINTFRIKSGNENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSSVLRLTIIVGP
FSF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 52.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001034438
Locus ID 2202
UniProt ID Q12805
Cytogenetics 2p16.1
RefSeq Size 3053
RefSeq ORF 1479
Synonyms DHRD; DRAD; FBLN3; FBNL; FIBL-3; MLVT; MTLV; S1-5
Summary This gene encodes a member of the fibulin family of extracellular matrix glycoproteins. Like all members of this family, the encoded protein contains tandemly repeated epidermal growth factor-like repeats followed by a C-terminus fibulin-type domain. This gene is upregulated in malignant gliomas and may play a role in the aggressive nature of these tumors. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy. Alternatively spliced transcript variants that encode the same protein have been described.[provided by RefSeq, Nov 2009]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:EFEMP1 (NM_001039349) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH304090 EFEMP1 MS Standard C13 and N15-labeled recombinant protein (NP_001034438) 10 ug
$3,255.00
PH314953 EFEMP1 MS Standard C13 and N15-labeled recombinant protein (NP_004096) 10 ug
$3,255.00
PH316753 EFEMP1 MS Standard C13 and N15-labeled recombinant protein (NP_001034437) 10 ug
$3,255.00
LC418212 EFEMP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418212 Transient overexpression lysate of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1 100 ug
$436.00
TP314953 Recombinant protein of human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1, 20 µg 20 ug
$737.00
TP316753 Recombinant protein of human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.