Ribonuclease H2, subunit A (RNASEH2A) (NM_006397) Human Recombinant Protein

  • Product Brand Image
SKU
TP304032
Recombinant protein of human ribonuclease H2, subunit A (RNASEH2A), 20 µg
In Control Promo
  $737.00
In Stock*
Bulk/Customize
Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC204032 protein sequence
Red=Cloning site Green=Tags(s)

MDLSELERDNTGRCRLSSPVPAVCRKEPCVLGVDEAGRGPVLGPMVYAICYCPLPRLADLEALKVADSKT
LLESERERLFAKMEDTDFVGWALDVLSPNLISTSMLGRVKYNLNSLSHDTATGLIQYALDQGVNVTQVFV
DTVGMPETYQARLQQSFPGIEVTVKAKADALYPVVSAASICAKVARDQAVKKWQFVEKLQDLDTDYGSGY
PNDPKTKAWLKEHVEPVFGFPQFVRFSWRTAQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQAR
PRSSHRYFLERGQESATSL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 33.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006388
Locus ID 10535
UniProt ID O75792
Cytogenetics 19p13.13
RefSeq Size 1148
RefSeq ORF 897
Synonyms AGS4; JUNB; RNASEHI; RNHIA; RNHL; THSD8
Summary The protein encoded by this gene is a component of the heterotrimeric type II ribonuclease H enzyme (RNAseH2). RNAseH2 is the major source of ribonuclease H activity in mammalian cells and endonucleolytically cleaves ribonucleotides. It is predicted to remove Okazaki fragment RNA primers during lagging strand DNA synthesis and to excise single ribonucleotides from DNA-DNA duplexes. Mutations in this gene cause Aicardi-Goutieres Syndrome (AGS), a an autosomal recessive neurological disorder characterized by progressive microcephaly and psychomotor retardation, intracranial calcifications, elevated levels of interferon-alpha and white blood cells in the cerebrospinal fluid.provided by RefSeq, Aug 2009
Protein Categories Immune system diseases, Intracellular Proteins
Protein Pathways DNA replication
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "Ribonuclease H2, subunit A" proteins (4)
SKU Description Size Price
PH304032 RNASEH2A MS Standard C13 and N15-labeled recombinant protein (NP_006388) 10 ug
$3,360.00
LC416666 RNASEH2A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416666 Transient overexpression lysate of ribonuclease H2, subunit A (RNASEH2A) 100 ug
$436.00
TP762504 Purified recombinant protein of Human ribonuclease H2, subunit A (RNASEH2A), full length, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$240.00
OriGene AI

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.