Ribonuclease H2, subunit A (RNASEH2A) (NM_006397) Human Mass Spec Standard

SKU
PH304032
RNASEH2A MS Standard C13 and N15-labeled recombinant protein (NP_006388)
  $3,360.00
3 Weeks*
Bulk/Customize
Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204032
Predicted MW 33.4 kDa
Protein Sequence
Protein Sequence
>RC204032 protein sequence
Red=Cloning site Green=Tags(s)

MDLSELERDNTGRCRLSSPVPAVCRKEPCVLGVDEAGRGPVLGPMVYAICYCPLPRLADLEALKVADSKT
LLESERERLFAKMEDTDFVGWALDVLSPNLISTSMLGRVKYNLNSLSHDTATGLIQYALDQGVNVTQVFV
DTVGMPETYQARLQQSFPGIEVTVKAKADALYPVVSAASICAKVARDQAVKKWQFVEKLQDLDTDYGSGY
PNDPKTKAWLKEHVEPVFGFPQFVRFSWRTAQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQAR
PRSSHRYFLERGQESATSL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006388
RefSeq Size 1148
RefSeq ORF 897
Synonyms AGS4; JUNB; RNASEHI; RNHIA; RNHL; THSD8
Locus ID 10535
UniProt ID O75792
Cytogenetics 19p13.13
Summary The protein encoded by this gene is a component of the heterotrimeric type II ribonuclease H enzyme (RNAseH2). RNAseH2 is the major source of ribonuclease H activity in mammalian cells and endonucleolytically cleaves ribonucleotides. It is predicted to remove Okazaki fragment RNA primers during lagging strand DNA synthesis and to excise single ribonucleotides from DNA-DNA duplexes. Mutations in this gene cause Aicardi-Goutieres Syndrome (AGS), a an autosomal recessive neurological disorder characterized by progressive microcephaly and psychomotor retardation, intracranial calcifications, elevated levels of interferon-alpha and white blood cells in the cerebrospinal fluid.provided by RefSeq, Aug 2009
Protein Pathways DNA replication
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "Ribonuclease H2, subunit A" proteins (4)
SKU Description Size Price
LC416666 RNASEH2A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416666 Transient overexpression lysate of ribonuclease H2, subunit A (RNASEH2A) 100 ug
$436.00
TP304032 Recombinant protein of human ribonuclease H2, subunit A (RNASEH2A), 20 µg 20 ug
$737.00
TP762504 Purified recombinant protein of Human ribonuclease H2, subunit A (RNASEH2A), full length, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$240.00

Welcome to OriGene AI!

I'm your AI-powered guide to everything OriGene.
Ask me anything:

  • Product specs
  • Ordering help
  • Technical questions
  • How to find exactly what your experiment needs

Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.

Velaro Chat Img

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.