Tropomyosin 2 (TPM2) (NM_213674) Human Recombinant Protein
SKU
TP304007
Recombinant protein of human tropomyosin 2 (beta) (TPM2), transcript variant 2, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC204007 protein sequence
Red=Cloning site Green=Tags(s) MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKYSESVKEAQEK LEQAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEK MELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSEERAEVAESRARQLEEELRTMDQALKSLMAS EEEYSTKEDKYEEEIKLLEEKLKEAETRAEFAERSVAKLEKTIDDLEETLASAKEENVEIHQTLDQTLLE LNNL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_998839 |
Locus ID | 7169 |
UniProt ID | P07951 |
Cytogenetics | 9p13.3 |
RefSeq Size | 1182 |
RefSeq ORF | 852 |
Synonyms | AMCD1; DA1; DA2B; DA2B4; HEL-S-273; NEM4; TMSB |
Summary | This gene encodes beta-tropomyosin, a member of the actin filament binding protein family, and mainly expressed in slow, type 1 muscle fibers. Mutations in this gene can alter the expression of other sarcomeric tropomyosin proteins, and cause cap disease, nemaline myopathy and distal arthrogryposis syndromes. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Mar 2009] |
Protein Pathways | Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM) |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH304007 | TPM2 MS Standard C13 and N15-labeled recombinant protein (NP_998839) | 10 ug |
$3,255.00
|
|
PH319648 | TPM2 MS Standard C13 and N15-labeled recombinant protein (NP_003280) | 10 ug |
$3,255.00
|
|
LC403737 | TPM2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC418786 | TPM2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY403737 | Transient overexpression lysate of tropomyosin 2 (beta) (TPM2), transcript variant 2 | 100 ug |
$436.00
|
|
LY418786 | Transient overexpression lysate of tropomyosin 2 (beta) (TPM2), transcript variant 1 | 100 ug |
$436.00
|
|
TP319648 | Recombinant protein of human tropomyosin 2 (beta) (TPM2), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.