Tropomyosin 2 (TPM2) (NM_213674) Human Mass Spec Standard

SKU
PH304007
TPM2 MS Standard C13 and N15-labeled recombinant protein (NP_998839)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204007]
Predicted MW 33 kDa
Protein Sequence
Protein Sequence
>RC204007 protein sequence
Red=Cloning site Green=Tags(s)

MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKYSESVKEAQEK
LEQAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEK
MELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSEERAEVAESRARQLEEELRTMDQALKSLMAS
EEEYSTKEDKYEEEIKLLEEKLKEAETRAEFAERSVAKLEKTIDDLEETLASAKEENVEIHQTLDQTLLE
LNNL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_998839
RefSeq Size 1182
RefSeq ORF 852
Synonyms AMCD1; DA1; DA2B; DA2B4; HEL-S-273; NEM4; TMSB
Locus ID 7169
UniProt ID P07951
Cytogenetics 9p13.3
Summary This gene encodes beta-tropomyosin, a member of the actin filament binding protein family, and mainly expressed in slow, type 1 muscle fibers. Mutations in this gene can alter the expression of other sarcomeric tropomyosin proteins, and cause cap disease, nemaline myopathy and distal arthrogryposis syndromes. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Mar 2009]
Protein Pathways Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM)
Write Your Own Review
You're reviewing:Tropomyosin 2 (TPM2) (NM_213674) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH319648 TPM2 MS Standard C13 and N15-labeled recombinant protein (NP_003280) 10 ug
$3,255.00
LC403737 TPM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC418786 TPM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403737 Transient overexpression lysate of tropomyosin 2 (beta) (TPM2), transcript variant 2 100 ug
$436.00
LY418786 Transient overexpression lysate of tropomyosin 2 (beta) (TPM2), transcript variant 1 100 ug
$436.00
TP304007 Recombinant protein of human tropomyosin 2 (beta) (TPM2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP319648 Recombinant protein of human tropomyosin 2 (beta) (TPM2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.