NEU4 (NM_080741) Human Recombinant Protein

CAT#: TP303948

Recombinant protein of human sialidase 4 (NEU4), 20 µg

Product Images

NEU2 and NEU3 upregulate TGF-beta1 by PBMC. Human PBMC were incubated with or without recombinant human sialidases, NEU1 (OriGene TP300386), NEU2 (OriGene TP319858), NEU3 (OriGene TP316537), NEU4 (OriGene TP303948) for five days, then air-dried and stained for TGF-beta1. Positive staining appears pink, and counterstaining is blue. Bar is 0.1 mm. Figure cited from Sci Rep, PMID: 29118338

• 

  Coomassie blue staining of purified NEU4 protein (Cat# TP303948). The protein was produced from HEK293T cells transfected with NEU4 cDNA clone (Cat# RC203948) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203948 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MMSSAAFPRWLSMGVPRTPSRTVLFERERTGLTYRVPSLLPVPPGPTLLAFVEQRLSPDDSHAHRLVLRR
  GTLAGGSVRWGALHVLGTAALAEHRSMNPCPVHDAGTGTVFLFFIAVLGHTPEAVQIATGRNAARLCCVA
  SRDAGLSWGSARDLTEEAIGGAVQDWATFAVGPGHGVQLPSGRLLVPAYTYRVDRRECFGKICRTSPHSF
  AFYSDDHGRTWRCGGLVPNLRSGECQLAAVDGGQAGSFLYCNARSPLGSRVQALSTDEGTSFLPAERVAS
  LPETAWGCQGSIVGFPAPAPNRPRDDSWSVGPGSPLQPPLLGPGVHEPPEEAAVDPRGGQVPGGPFSRLQ
  PRGDGPRQPGPRPGVSGDVGSWTLALPMPFAAPPQSPTWLLYSHPVGRRARLHMGIRLSQSPLDPRSWTE
  PWVIYEGPSGYSDLASIGPAPEGGLVFACLYESGARTSYDEISFCTFSLREVLENVPASPKPPNLGDKPR
  GCCWPS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 52.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Bioactivity: Cell treatment (PMID: 29118338)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_542779
• Locus ID: 129807
• UniProt ID: Q8WWR8, Q3KR05
• Cytogenetics: 2q37.3
• Refseq Size: 2373
• Refseq ORF: 1488
• Summary: The protein encoded by this gene belongs to a family of glycohydrolytic enzymes, which remove terminal sialic acid residues from various sialo derivatives, such as glycoproteins, glycolipids, oligosaccharides, and gangliosides. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Nov 2009]
• Protein Pathways: Other glycan degradation, Sphingolipid metabolism