LITAF (NM_004862) Human Recombinant Protein

SKU
TP303938
Recombinant protein of human lipopolysaccharide-induced TNF factor (LITAF), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203938 protein sequence
Red=Cloning site Green=Tags(s)

MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPN
NNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDA
LQDVDHYCPNCRALLGTYKRL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 16.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004853
Locus ID 9516
UniProt ID Q99732
Cytogenetics 16p13.13
RefSeq Size 2642
RefSeq ORF 483
Synonyms PIG7; SIMPLE; TP53I7
Summary Lipopolysaccharide is a potent stimulator of monocytes and macrophages, causing secretion of tumor necrosis factor-alpha (TNF-alpha) and other inflammatory mediators. This gene encodes lipopolysaccharide-induced TNF-alpha factor, which is a DNA-binding protein and can mediate the TNF-alpha expression by direct binding to the promoter region of the TNF-alpha gene. The transcription of this gene is induced by tumor suppressor p53 and has been implicated in the p53-induced apoptotic pathway. Mutations in this gene cause Charcot-Marie-Tooth disease type 1C (CMT1C) and may be involved in the carcinogenesis of extramammary Paget's disease (EMPD). Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2014]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:LITAF (NM_004862) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303938 LITAF MS Standard C13 and N15-labeled recombinant protein (NP_004853) 10 ug
$3,255.00
LC417698 LITAF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427883 LITAF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427884 LITAF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417698 Transient overexpression lysate of lipopolysaccharide-induced TNF factor (LITAF), transcript variant 1 100 ug
$436.00
LY427883 Transient overexpression lysate of lipopolysaccharide-induced TNF factor (LITAF), transcript variant 2 100 ug
$436.00
LY427884 Transient overexpression lysate of lipopolysaccharide-induced TNF factor (LITAF), transcript variant 3 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.