LITAF (NM_004862) Human Tagged ORF Clone
SKU
RC203938
LITAF (Myc-DDK-tagged)-Human lipopolysaccharide-induced TNF factor (LITAF), transcript variant 1
-
TrueORF Gold
Protein expression verified by Western blot, fully sequenced and in stock
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | LITAF |
Synonyms | PIG7; SIMPLE; TP53I7 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC203938 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCGGTTCCAGGACCTTACCAGGCGGCCACTGGGCCTTCCTCAGCACCATCCGCACCTCCATCCTATG AAGAGACAGTGGCTGTTAACAGTTATTACCCCACACCTCCAGCTCCCATGCCTGGGCCAACTACGGGGCT TGTGACGGGGCCTGATGGGAAGGGCATGAATCCTCCTTCGTATTATACCCAGCCAGCGCCCATCCCCAAT AACAATCCAATTACCGTGCAGACGGTCTACGTGCAGCACCCCATCACCTTTTTGGACCGCCCTATCCAAA TGTGTTGTCCTTCCTGCAACAAGATGATCGTGAGTCAGCTGTCCTATAACGCCGGTGCTCTGACCTGGCT GTCCTGCGGGAGCCTGTGCCTGCTGGGGTGCATAGCGGGCTGCTGCTTCATCCCCTTCTGCGTGGATGCC CTGCAGGACGTGGACCATTACTGTCCCAACTGCAGAGCTCTCCTGGGCACCTACAAGCGTTTG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC203938 protein sequence
Red=Cloning site Green=Tags(s) MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPN NNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDA LQDVDHYCPNCRALLGTYKRL myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_004862 |
ORF Size | 483 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_004862.3 |
RefSeq Size | 2642 bp |
RefSeq ORF | 486 bp |
Locus ID | 9516 |
UniProt ID | Q99732 |
Cytogenetics | 16p13.13 |
Domains | LITAF |
Protein Families | Druggable Genome, Transcription Factors |
MW | 17.1 kDa |
Summary | Lipopolysaccharide is a potent stimulator of monocytes and macrophages, causing secretion of tumor necrosis factor-alpha (TNF-alpha) and other inflammatory mediators. This gene encodes lipopolysaccharide-induced TNF-alpha factor, which is a DNA-binding protein and can mediate the TNF-alpha expression by direct binding to the promoter region of the TNF-alpha gene. The transcription of this gene is induced by tumor suppressor p53 and has been implicated in the p53-induced apoptotic pathway. Mutations in this gene cause Charcot-Marie-Tooth disease type 1C (CMT1C) and may be involved in the carcinogenesis of extramammary Paget's disease (EMPD). Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2014] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC203938L3 | Lenti ORF clone of Human lipopolysaccharide-induced TNF factor (LITAF), transcript variant 1, Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC203938L4 | Lenti ORF clone of Human lipopolysaccharide-induced TNF factor (LITAF), transcript variant 1, mGFP tagged | 10 ug |
$450.00
|
|
RG203938 | LITAF (tGFP-tagged) - Human lipopolysaccharide-induced TNF factor (LITAF), transcript variant 1 | 10 ug |
$489.00
|
|
SC108532 | LITAF (untagged)-Human lipopolysaccharide-induced TNF factor (LITAF), transcript variant 1 | 10 ug |
$150.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.