HNRPLL (HNRNPLL) (NM_138394) Human Recombinant Protein
SKU
TP303569
Recombinant protein of human heterogeneous nuclear ribonucleoprotein L-like (HNRPLL), transcript variant 1, 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC203569 protein sequence
Red=Cloning site Green=Tags(s) MSSSSSSPRETYEEDREYESQAKRLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHH KVSVSPVVHVRGLCESVVEADLVEALEKFGTICYVMMMPFKRQALVEFENIDSAKECVTFAADEPVYIAG QQAFFNYSTSKRITRPGNTDDPSGGNKVLLLSIQNPLYPITVDVLYTVCNPVGKVQRIVIFKRNGIQAMV EFESVLCAQKAKAALNGADIYAGCCTLKIEYARPTRLNVIRNDNDSWDYTKPYLGRRDRGKGRQRQAILG EHPSSFRHDGYGSHGPLLPLPSRYRMGSRDTPELVAYPLPQASSSYMHGGNPSGSVVMVSGLHQLKMNCS RVFNLFCLYGNIEKVKFMKTIPGTALVEMGDEYAVERAVTHLNNVKLFGKRLNVCVSKQHSVVPSQIFEL EDGTSSYKDFAMSKNNRFTSAGQASKNIIQPPSCVLHYYNVPLCVTEETFTKLCNDHEVLTFIKYKVFDA KPSAKTLSGLLEWECKTDAVEALTALNHYQIRVPNGSNPYTLKLCFSTSSHL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 59.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_612403 |
Locus ID | 92906 |
UniProt ID | Q8WVV9 |
Cytogenetics | 2p22.1 |
RefSeq Size | 3053 |
RefSeq ORF | 1626 |
Synonyms | HNRPLL; SRRF |
Summary | HNRNPLL is a master regulator of activation-induced alternative splicing in T cells. In particular, it alters splicing of CD45 (PTPRC; MIM 151460), a tyrosine phosphatase essential for T-cell development and activation (Oberdoerffer et al., 2008 [PubMed 18669861]).[supplied by OMIM, Aug 2008] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH303569 | HNRPLL MS Standard C13 and N15-labeled recombinant protein (NP_612403) | 10 ug |
$3,255.00
|
|
LC408658 | HNRNPLL HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428233 | HNRNPLL HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY408658 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein L-like (HNRPLL), transcript variant 1 | 100 ug |
$436.00
|
|
LY428233 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein L-like (HNRPLL), transcript variant 2 | 100 ug |
$436.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.