HNRPLL (HNRNPLL) (NM_138394) Human Recombinant Protein

SKU
TP303569
Recombinant protein of human heterogeneous nuclear ribonucleoprotein L-like (HNRPLL), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203569 protein sequence
Red=Cloning site Green=Tags(s)

MSSSSSSPRETYEEDREYESQAKRLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHH
KVSVSPVVHVRGLCESVVEADLVEALEKFGTICYVMMMPFKRQALVEFENIDSAKECVTFAADEPVYIAG
QQAFFNYSTSKRITRPGNTDDPSGGNKVLLLSIQNPLYPITVDVLYTVCNPVGKVQRIVIFKRNGIQAMV
EFESVLCAQKAKAALNGADIYAGCCTLKIEYARPTRLNVIRNDNDSWDYTKPYLGRRDRGKGRQRQAILG
EHPSSFRHDGYGSHGPLLPLPSRYRMGSRDTPELVAYPLPQASSSYMHGGNPSGSVVMVSGLHQLKMNCS
RVFNLFCLYGNIEKVKFMKTIPGTALVEMGDEYAVERAVTHLNNVKLFGKRLNVCVSKQHSVVPSQIFEL
EDGTSSYKDFAMSKNNRFTSAGQASKNIIQPPSCVLHYYNVPLCVTEETFTKLCNDHEVLTFIKYKVFDA
KPSAKTLSGLLEWECKTDAVEALTALNHYQIRVPNGSNPYTLKLCFSTSSHL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 59.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_612403
Locus ID 92906
UniProt ID Q8WVV9
Cytogenetics 2p22.1
RefSeq Size 3053
RefSeq ORF 1626
Synonyms HNRPLL; SRRF
Summary HNRNPLL is a master regulator of activation-induced alternative splicing in T cells. In particular, it alters splicing of CD45 (PTPRC; MIM 151460), a tyrosine phosphatase essential for T-cell development and activation (Oberdoerffer et al., 2008 [PubMed 18669861]).[supplied by OMIM, Aug 2008]
Write Your Own Review
You're reviewing:HNRPLL (HNRNPLL) (NM_138394) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303569 HNRPLL MS Standard C13 and N15-labeled recombinant protein (NP_612403) 10 ug
$3,255.00
LC408658 HNRNPLL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428233 HNRNPLL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408658 Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein L-like (HNRPLL), transcript variant 1 100 ug
$436.00
LY428233 Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein L-like (HNRPLL), transcript variant 2 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.