HNRPLL (HNRNPLL) Rabbit Polyclonal Antibody

SKU TA343980

Rabbit Polyclonal Anti-HNRPLL Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HNRPLL antibody: synthetic peptide directed towards the N terminal of human HNRPLL. Synthetic peptide located within the following region: RLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHHKVS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 60 kDa
• Gene Name: heterogeneous nuclear ribonucleoprotein L like
• Database Link:
  NP_612403
  Q8WVV9
• Background: HNRPLL contains 3 RRM (RNA recognition motif) domains and may bind RNA and plays a role in mRNA processing.
• Synonyms: HNRPLL; SRRF
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%

Reference Data