Transketolase (TKT) (NM_001064) Human Recombinant Protein

SKU
TP303497
Recombinant protein of human transketolase (TKT), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203497 protein sequence
Red=Cloning site Green=Tags(s)

MESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVLFFHTMRYKSQDPRNPHNDR
FVLSKGHAAPILYAVWAEAGFLAEAELLNLRKISSDLDGHPVPKQAFTDVATGSLGQGLGAACGMAYTGK
YFDKASYRVYCLLGDGELSEGSVWEAMAFASIYKLDNLVAILDINRLGQSDPAPLQHQMDIYQKRCEAFG
WHAIIVDGHSVEELCKAFGQAKHQPTAIIAKTFKGRGITGVEDKESWHGKPLPKNMAEQIIQEIYSQIQS
KKKILATPPQEDAPSVDIANIRMPSLPSYKVGDKIATRKAYGQALAKLGHASDRIIALDGDTKNSTFSEI
FKKEHPDRFIECYIAEQNMVSIAVGCATRNRTVPFCSTFAAFFTRAFDQIRMAAISESNINLCGSHCGVS
IGEDGPSQMALEDLAMFRSVPTSTVFYPSDGVATEKAVELAANTKGICFIRTSRPENAIIYNNNEDFQVG
QAKVVLKSKDDQVTVIGAGVTLHEALAAAELLKKEKINIRVLDPFTIKPLDRKLILDSARATKGRILTVE
DHYYEGGIGEAVSSAVVGEPGITVTHLAVNRVPRSGKPAELLKMFGIDRDAIAQAVRGLITKA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 67.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001055
Locus ID 7086
UniProt ID P29401
Cytogenetics 3p21.1
RefSeq Size 2179
RefSeq ORF 1869
Synonyms HEL-S-48; HEL107; SDDHD; TK; TKT1
Summary This gene encodes a thiamine-dependent enzyme which plays a role in the channeling of excess sugar phosphates to glycolysis in the pentose phosphate pathway. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Apr 2012]
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Pentose phosphate pathway
Write Your Own Review
You're reviewing:Transketolase (TKT) (NM_001064) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303497 TKT MS Standard C13 and N15-labeled recombinant protein (NP_001055) 10 ug
$3,255.00
PH326037 TKT MS Standard C13 and N15-labeled recombinant protein (NP_001128527) 10 ug
$3,255.00
LC400434 TKT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427542 TKT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400434 Transient overexpression lysate of transketolase (TKT), transcript variant 1 100 ug
$436.00
LY427542 Transient overexpression lysate of transketolase (TKT), transcript variant 2 100 ug
$436.00
TP326037 Recombinant protein of human transketolase (TKT), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.