Transketolase (TKT) (NM_001064) Human Mass Spec Standard

SKU
PH303497
TKT MS Standard C13 and N15-labeled recombinant protein (NP_001055)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203497]
Predicted MW 67.9 kDa
Protein Sequence
Protein Sequence
>RC203497 protein sequence
Red=Cloning site Green=Tags(s)

MESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVLFFHTMRYKSQDPRNPHNDR
FVLSKGHAAPILYAVWAEAGFLAEAELLNLRKISSDLDGHPVPKQAFTDVATGSLGQGLGAACGMAYTGK
YFDKASYRVYCLLGDGELSEGSVWEAMAFASIYKLDNLVAILDINRLGQSDPAPLQHQMDIYQKRCEAFG
WHAIIVDGHSVEELCKAFGQAKHQPTAIIAKTFKGRGITGVEDKESWHGKPLPKNMAEQIIQEIYSQIQS
KKKILATPPQEDAPSVDIANIRMPSLPSYKVGDKIATRKAYGQALAKLGHASDRIIALDGDTKNSTFSEI
FKKEHPDRFIECYIAEQNMVSIAVGCATRNRTVPFCSTFAAFFTRAFDQIRMAAISESNINLCGSHCGVS
IGEDGPSQMALEDLAMFRSVPTSTVFYPSDGVATEKAVELAANTKGICFIRTSRPENAIIYNNNEDFQVG
QAKVVLKSKDDQVTVIGAGVTLHEALAAAELLKKEKINIRVLDPFTIKPLDRKLILDSARATKGRILTVE
DHYYEGGIGEAVSSAVVGEPGITVTHLAVNRVPRSGKPAELLKMFGIDRDAIAQAVRGLITKA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001055
RefSeq Size 2179
RefSeq ORF 1869
Synonyms HEL-S-48; HEL107; SDDHD; TK; TKT1
Locus ID 7086
UniProt ID P29401
Cytogenetics 3p21.1
Summary This gene encodes a thiamine-dependent enzyme which plays a role in the channeling of excess sugar phosphates to glycolysis in the pentose phosphate pathway. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Apr 2012]
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Pentose phosphate pathway
Write Your Own Review
You're reviewing:Transketolase (TKT) (NM_001064) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH326037 TKT MS Standard C13 and N15-labeled recombinant protein (NP_001128527) 10 ug
$3,255.00
LC400434 TKT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427542 TKT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400434 Transient overexpression lysate of transketolase (TKT), transcript variant 1 100 ug
$436.00
LY427542 Transient overexpression lysate of transketolase (TKT), transcript variant 2 100 ug
$436.00
TP303497 Recombinant protein of human transketolase (TKT), transcript variant 1, 20 µg 20 ug
$737.00
TP326037 Recombinant protein of human transketolase (TKT), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.