RGS10 (NM_001005339) Human Recombinant Protein

SKU
TP303488
Recombinant protein of human regulator of G-protein signaling 10 (RGS10), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203488 protein sequence
Red=Cloning site Green=Tags(s)

MFNRAVSRLSRKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLF
WLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKY
DSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 21 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001005339
Locus ID 6001
UniProt ID O43665
Cytogenetics 10q26.11
RefSeq Size 910
RefSeq ORF 543
Summary Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 10 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. This protein associates specifically with the activated forms of the two related G-protein subunits, G-alphai3 and G-alphaz but fails to interact with the structurally and functionally distinct G-alpha subunits. Regulator of G protein signaling 10 protein is localized in the nucleus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:RGS10 (NM_001005339) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303488 RGS10 MS Standard C13 and N15-labeled recombinant protein (NP_001005339) 10 ug
$3,255.00
PH315410 RGS10 MS Standard C13 and N15-labeled recombinant protein (NP_002916) 10 ug
$3,255.00
LC419006 RGS10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423865 RGS10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419006 Transient overexpression lysate of regulator of G-protein signaling 10 (RGS10), transcript variant 2 100 ug
$436.00
LY423865 Transient overexpression lysate of regulator of G-protein signaling 10 (RGS10), transcript variant 1 100 ug
$436.00
TP315410 Recombinant protein of human regulator of G-protein signaling 10 (RGS10), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.