RGS10 (NM_001005339) Human Mass Spec Standard

SKU
PH303488
RGS10 MS Standard C13 and N15-labeled recombinant protein (NP_001005339)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203488]
Predicted MW 21.2 kDa
Protein Sequence
Protein Sequence
>RC203488 protein sequence
Red=Cloning site Green=Tags(s)

MFNRAVSRLSRKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLF
WLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKY
DSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001005339
RefSeq Size 910
RefSeq ORF 543
Locus ID 6001
UniProt ID O43665
Cytogenetics 10q26.11
Summary Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 10 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. This protein associates specifically with the activated forms of the two related G-protein subunits, G-alphai3 and G-alphaz but fails to interact with the structurally and functionally distinct G-alpha subunits. Regulator of G protein signaling 10 protein is localized in the nucleus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:RGS10 (NM_001005339) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH315410 RGS10 MS Standard C13 and N15-labeled recombinant protein (NP_002916) 10 ug
$3,255.00
LC419006 RGS10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423865 RGS10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419006 Transient overexpression lysate of regulator of G-protein signaling 10 (RGS10), transcript variant 2 100 ug
$436.00
LY423865 Transient overexpression lysate of regulator of G-protein signaling 10 (RGS10), transcript variant 1 100 ug
$436.00
TP303488 Recombinant protein of human regulator of G-protein signaling 10 (RGS10), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP315410 Recombinant protein of human regulator of G-protein signaling 10 (RGS10), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.