OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Destrin (DSTN) (NM_006870) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP303419
Recombinant protein of human destrin (actin depolymerizing factor) (DSTN), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA502608 DSTN (Destrin) mouse monoclonal antibody, clone OTI2F7 (formerly 2F7) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Destrin or NM_006870"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203419 protein sequence
Red=Cloning site Green=Tags(s)

MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKH
FVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGP
EDLNRACIAEKLGGSLIVAFEGCPV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 18.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006861
Locus ID 11034
UniProt ID P60981
Cytogenetics 20p12.1
RefSeq Size 1614
RefSeq ORF 495
Synonyms ACTDP; ADF; bA462D18.2; HEL32
Summary The product of this gene belongs to the actin-binding proteins ADF family. This family of proteins is responsible for enhancing the turnover rate of actin in vivo. This gene encodes the actin depolymerizing protein that severs actin filaments (F-actin) and binds to actin monomers (G-actin). Two transcript variants encoding distinct isoforms have been identified for this gene. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Destrin" proteins (5)
SKU Description Size Price
PH303419 DSTN MS Standard C13 and N15-labeled recombinant protein (NP_006861) 10 ug
$3,360.00
LC402051 Lyophilized DSTN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423272 Lyophilized DSTN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402051 Transient overexpression lysate of destrin (actin depolymerizing factor) (DSTN), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY423272 Transient overexpression lysate of destrin (actin depolymerizing factor) (DSTN), transcript variant 2 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products