Destrin (DSTN) (NM_006870) Human Recombinant Protein
SKU
TP303419
Recombinant protein of human destrin (actin depolymerizing factor) (DSTN), transcript variant 1, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC203419 protein sequence
Red=Cloning site Green=Tags(s) MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKH FVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGP EDLNRACIAEKLGGSLIVAFEGCPV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_006861 |
Locus ID | 11034 |
UniProt ID | P60981 |
Cytogenetics | 20p12.1 |
RefSeq Size | 1614 |
RefSeq ORF | 495 |
Synonyms | ACTDP; ADF; bA462D18.2; HEL32 |
Summary | The product of this gene belongs to the actin-binding proteins ADF family. This family of proteins is responsible for enhancing the turnover rate of actin in vivo. This gene encodes the actin depolymerizing protein that severs actin filaments (F-actin) and binds to actin monomers (G-actin). Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH303419 | DSTN MS Standard C13 and N15-labeled recombinant protein (NP_006861) | 10 ug |
$3,255.00
|
|
LC402051 | DSTN HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC423272 | DSTN HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY402051 | Transient overexpression lysate of destrin (actin depolymerizing factor) (DSTN), transcript variant 1 | 100 ug |
$436.00
|
|
LY423272 | Transient overexpression lysate of destrin (actin depolymerizing factor) (DSTN), transcript variant 2 | 100 ug |
$436.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.