OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Destrin (DSTN) (NM_006870) Human Mass Spec Standard

Be the first to review this product
SKU
PH303419
DSTN MS Standard C13 and N15-labeled recombinant protein (NP_006861)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502608 DSTN (Destrin) mouse monoclonal antibody, clone OTI2F7 (formerly 2F7) 100 ul
$447.00
LY402051 Transient overexpression lysate of destrin (actin depolymerizing factor) (DSTN), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "Destrin or NM_006870"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203419
Predicted MW 18.5 kDa
Protein Sequence
Protein Sequence
>RC203419 protein sequence
Red=Cloning site Green=Tags(s)

MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKH
FVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGP
EDLNRACIAEKLGGSLIVAFEGCPV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006861
RefSeq Size 1614
RefSeq ORF 495
Synonyms ACTDP; ADF; bA462D18.2; HEL32
Locus ID 11034
UniProt ID P60981
Cytogenetics 20p12.1
Summary The product of this gene belongs to the actin-binding proteins ADF family. This family of proteins is responsible for enhancing the turnover rate of actin in vivo. This gene encodes the actin depolymerizing protein that severs actin filaments (F-actin) and binds to actin monomers (G-actin). Two transcript variants encoding distinct isoforms have been identified for this gene. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Destrin" proteins (5)
SKU Description Size Price
LC402051 Lyophilized DSTN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423272 Lyophilized DSTN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402051 Transient overexpression lysate of destrin (actin depolymerizing factor) (DSTN), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY423272 Transient overexpression lysate of destrin (actin depolymerizing factor) (DSTN), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP303419 Recombinant protein of human destrin (actin depolymerizing factor) (DSTN), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products