OriGene Logo

CAB39L (NM_030925) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP303394
Recombinant protein of human calcium binding protein 39-like (CAB39L), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
In Control Promo
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA349728 Rabbit Polyclonal Anti-CAB39L Antibody
100 ul
$205.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CAB39L or NM_030925"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203394 protein sequence
Red=Cloning site Green=Tags(s)

MKKMPLFSKSHKNPAEIVKILKDNLAILEKQDKKTDKASEEVSKSLQAMKEILCGTNEKEPPTEAVAQLA
QELYSSGLLVTLIADLQLIDFEEKKDVTQIFNNILRRQIGTRSPTVEYISAHPHILFMLLKGYEAPQIAL
RCGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIASDAFATFKDLLTRHKVLVADFLEQNYDTIF
EDYEKLLQSENYVTKRQSLKLLGELILDRHNFAIMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVF
VASPHKTQPIVEILLKNQPKLIEFLSSFQKERTDDEQFADEKNYLIKQIRDLKKTAP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 38.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_112187
Locus ID 81617
UniProt ID Q9H9S4
Cytogenetics 13q14.2
RefSeq Size 3631
RefSeq ORF 1011
Synonyms bA103J18.3; MO2L; MO25-BETA
Summary Component of a complex that binds and activates STK11/LKB1. In the complex, required to stabilize the interaction between CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta) and STK11/LKB1 (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Protein Pathways mTOR signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "CAB39L" proteins (7)
SKU Description Size Price
PH303394 CAB39L MS Standard C13 and N15-labeled recombinant protein (NP_112187) 10 ug
$3,360.00
PH311881 CAB39L MS Standard C13 and N15-labeled recombinant protein (NP_001073138) 10 ug
$3,360.00
LC410660 CAB39L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421532 CAB39L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410660 Transient overexpression lysate of calcium binding protein 39-like (CAB39L), transcript variant 1 100 ug
$436.00
LY421532 Transient overexpression lysate of calcium binding protein 39-like (CAB39L), transcript variant 2 100 ug
$436.00
TP311881 Recombinant protein of human calcium binding protein 39-like (CAB39L), transcript variant 2, 20 µg 20 ug
$867.00
OriGene AI

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.