CAB39L (NM_001079670) Human Mass Spec Standard

SKU
PH311881
CAB39L MS Standard C13 and N15-labeled recombinant protein (NP_001073138)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211881]
Predicted MW 39.2 kDa
Protein Sequence
Protein Sequence
>RC211881 protein sequence
Red=Cloning site Green=Tags(s)

MKKMPLFSKSHKNPAEIVKILKDNLAILEKQDKKTDKASEEVSKSLQAMKEILCGTNEKEPPTEAVAQLA
QELYSSGLLVTLIADLQLIDFEEKKDVTQIFNNILRRQIGTRSPTVEYISAHPHILFMLLKGYEAPQIAL
RCGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIASDAFATFKDLLTRHKVLVADFLEQNYDTIF
EDYEKLLQSENYVTKRQSLKLLGELILDRHNFAIMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVF
VASPHKTQPIVEILLKNQPKLIEFLSSFQKERTDDEQFADEKNYLIKQIRDLKKTAP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001073138
RefSeq Size 3580
RefSeq ORF 1011
Synonyms bA103J18.3; MO2L; MO25-BETA
Locus ID 81617
UniProt ID Q9H9S4
Cytogenetics 13q14.2
Summary Component of a complex that binds and activates STK11/LKB1. In the complex, required to stabilize the interaction between CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta) and STK11/LKB1 (By similarity).[UniProtKB/Swiss-Prot Function]
Protein Pathways mTOR signaling pathway
Write Your Own Review
You're reviewing:CAB39L (NM_001079670) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH303394 CAB39L MS Standard C13 and N15-labeled recombinant protein (NP_112187) 10 ug
$3,255.00
LC410660 CAB39L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421532 CAB39L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410660 Transient overexpression lysate of calcium binding protein 39-like (CAB39L), transcript variant 1 100 ug
$436.00
LY421532 Transient overexpression lysate of calcium binding protein 39-like (CAB39L), transcript variant 2 100 ug
$436.00
TP303394 Recombinant protein of human calcium binding protein 39-like (CAB39L), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP311881 Recombinant protein of human calcium binding protein 39-like (CAB39L), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.