OriGene Logo

CAB39L (NM_001079670) Human Mass Spec Standard

Be the first to review this product
SKU
PH311881
CAB39L MS Standard C13 and N15-labeled recombinant protein (NP_001073138)
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA349728 Rabbit Polyclonal Anti-CAB39L Antibody
100 ul
$205.00
LY410660 Transient overexpression lysate of calcium binding protein 39-like (CAB39L), transcript variant 1
100 ug
$436.00

Other products for "CAB39L or NM_001079670"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211881
Predicted MW 39.2 kDa
Protein Sequence
Protein Sequence
>RC211881 protein sequence
Red=Cloning site Green=Tags(s)

MKKMPLFSKSHKNPAEIVKILKDNLAILEKQDKKTDKASEEVSKSLQAMKEILCGTNEKEPPTEAVAQLA
QELYSSGLLVTLIADLQLIDFEEKKDVTQIFNNILRRQIGTRSPTVEYISAHPHILFMLLKGYEAPQIAL
RCGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIASDAFATFKDLLTRHKVLVADFLEQNYDTIF
EDYEKLLQSENYVTKRQSLKLLGELILDRHNFAIMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVF
VASPHKTQPIVEILLKNQPKLIEFLSSFQKERTDDEQFADEKNYLIKQIRDLKKTAP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001073138
RefSeq Size 3580
RefSeq ORF 1011
Synonyms bA103J18.3; MO2L; MO25-BETA
Locus ID 81617
UniProt ID Q9H9S4
Cytogenetics 13q14.2
Summary Component of a complex that binds and activates STK11/LKB1. In the complex, required to stabilize the interaction between CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta) and STK11/LKB1 (By similarity).UniProtKB/Swiss-Prot Function
Protein Pathways mTOR signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "CAB39L" proteins (7)
SKU Description Size Price
PH303394 CAB39L MS Standard C13 and N15-labeled recombinant protein (NP_112187) 10 ug
$3,360.00
LC410660 CAB39L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421532 CAB39L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410660 Transient overexpression lysate of calcium binding protein 39-like (CAB39L), transcript variant 1 100 ug
$436.00
LY421532 Transient overexpression lysate of calcium binding protein 39-like (CAB39L), transcript variant 2 100 ug
$436.00
TP303394 Recombinant protein of human calcium binding protein 39-like (CAB39L), transcript variant 1, 20 µg 20 ug
$867.00
TP311881 Recombinant protein of human calcium binding protein 39-like (CAB39L), transcript variant 2, 20 µg 20 ug
$867.00

Welcome to OriGene AI!

I'm your AI-powered guide to everything OriGene.
Ask me anything:

  • Product specs
  • Ordering help
  • Technical questions
  • How to find exactly what your experiment needs

Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.

Velaro Chat Img

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.