CAB39L (NM_001079670) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC211881] |
Predicted MW | 39.2 kDa |
Protein Sequence |
Protein Sequence
>RC211881 protein sequence
Red=Cloning site Green=Tags(s) MKKMPLFSKSHKNPAEIVKILKDNLAILEKQDKKTDKASEEVSKSLQAMKEILCGTNEKEPPTEAVAQLA QELYSSGLLVTLIADLQLIDFEEKKDVTQIFNNILRRQIGTRSPTVEYISAHPHILFMLLKGYEAPQIAL RCGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIASDAFATFKDLLTRHKVLVADFLEQNYDTIF EDYEKLLQSENYVTKRQSLKLLGELILDRHNFAIMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVF VASPHKTQPIVEILLKNQPKLIEFLSSFQKERTDDEQFADEKNYLIKQIRDLKKTAP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001073138 |
RefSeq Size | 3580 |
RefSeq ORF | 1011 |
Synonyms | bA103J18.3; MO2L; MO25-BETA |
Locus ID | 81617 |
UniProt ID | Q9H9S4 |
Cytogenetics | 13q14.2 |
Summary | Component of a complex that binds and activates STK11/LKB1. In the complex, required to stabilize the interaction between CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta) and STK11/LKB1 (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Pathways | mTOR signaling pathway |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH303394 | CAB39L MS Standard C13 and N15-labeled recombinant protein (NP_112187) | 10 ug |
$3,255.00
|
|
LC410660 | CAB39L HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC421532 | CAB39L HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY410660 | Transient overexpression lysate of calcium binding protein 39-like (CAB39L), transcript variant 1 | 100 ug |
$436.00
|
|
LY421532 | Transient overexpression lysate of calcium binding protein 39-like (CAB39L), transcript variant 2 | 100 ug |
$436.00
|
|
TP303394 | Recombinant protein of human calcium binding protein 39-like (CAB39L), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP311881 | Recombinant protein of human calcium binding protein 39-like (CAB39L), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.