MNF1 (UQCC2) (NM_032340) Human Recombinant Protein

SKU
TP303347
Recombinant protein of human chromosome 6 open reading frame 125 (C6orf125), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203347 protein sequence
Red=Cloning site Green=Tags(s)

MAASRYRRFLKLCEEWPVDETKRGRDLGAYLRQRVAQAFREGENTQVAEPEACDQMYESLARLHSNYYKH
KYPRPRDTSFSGLSLEEYKLILSTDTLEELKEIDKGMWKKLQEKFAPKGPEEDHKA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 14.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_115716
Locus ID 84300
UniProt ID Q9BRT2
Cytogenetics 6p21.31
RefSeq Size 1355
RefSeq ORF 378
Synonyms bA6B20.2; C6orf125; C6orf126; Cbp6; M19; MC3DN7; MNF1
Summary This gene encodes a nucleoid protein localized to the mitochondria inner membrane. The encoded protein affects regulation of insulin secretion, mitochondrial ATP production, and myogenesis through modulation of mitochondrial respiratory chain activity. [provided by RefSeq, Oct 2012]
Write Your Own Review
You're reviewing:MNF1 (UQCC2) (NM_032340) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303347 C6orf125 MS Standard C13 and N15-labeled recombinant protein (NP_115716) 10 ug
$3,255.00
LC410177 UQCC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410177 Transient overexpression lysate of chromosome 6 open reading frame 125 (C6orf125) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.