MNF1 (UQCC2) (NM_032340) Human Mass Spec Standard

SKU
PH303347
C6orf125 MS Standard C13 and N15-labeled recombinant protein (NP_115716)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203347]
Predicted MW 14.9 kDa
Protein Sequence
Protein Sequence
>RC203347 protein sequence
Red=Cloning site Green=Tags(s)

MAASRYRRFLKLCEEWPVDETKRGRDLGAYLRQRVAQAFREGENTQVAEPEACDQMYESLARLHSNYYKH
KYPRPRDTSFSGLSLEEYKLILSTDTLEELKEIDKGMWKKLQEKFAPKGPEEDHKA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115716
RefSeq Size 1355
RefSeq ORF 378
Synonyms bA6B20.2; C6orf125; C6orf126; Cbp6; M19; MC3DN7; MNF1
Locus ID 84300
UniProt ID Q9BRT2
Cytogenetics 6p21.31
Summary This gene encodes a nucleoid protein localized to the mitochondria inner membrane. The encoded protein affects regulation of insulin secretion, mitochondrial ATP production, and myogenesis through modulation of mitochondrial respiratory chain activity. [provided by RefSeq, Oct 2012]
Write Your Own Review
You're reviewing:MNF1 (UQCC2) (NM_032340) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410177 UQCC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410177 Transient overexpression lysate of chromosome 6 open reading frame 125 (C6orf125) 100 ug
$436.00
TP303347 Recombinant protein of human chromosome 6 open reading frame 125 (C6orf125), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.