XTP4 (MIEN1) (NM_032339) Human Recombinant Protein

SKU
TP303346
Recombinant protein of human chromosome 17 open reading frame 37 (C17orf37), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203346 protein sequence
Red=Cloning site Green=Tags(s)

MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEIN
GQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 12.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_115715
Locus ID 84299
UniProt ID Q9BRT3
Cytogenetics 17q12
RefSeq Size 781
RefSeq ORF 345
Synonyms C17orf37; C35; ORB3; RDX12; XTP4
Summary Increases cell migration by inducing filopodia formation at the leading edge of migrating cells. Plays a role in regulation of apoptosis, possibly through control of CASP3. May be involved in a redox-related process.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:XTP4 (MIEN1) (NM_032339) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303346 C17orf37 MS Standard C13 and N15-labeled recombinant protein (NP_115715) 10 ug
$3,255.00
LC410176 MIEN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410176 Transient overexpression lysate of chromosome 17 open reading frame 37 (C17orf37) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.