XTP4 (MIEN1) (NM_032339) Human Mass Spec Standard

SKU PH303346

C17orf37 MS Standard C13 and N15-labeled recombinant protein (NP_115715)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC203346]
• Predicted MW: 12.4 kDa
• Protein Sequence:
  Protein Sequence

  >RC203346 protein sequence; Red=Cloning site Green=Tags(s); ; MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEIN; GQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_115715
• RefSeq Size: 781
• RefSeq ORF: 345
• Synonyms: C17orf37; C35; ORB3; RDX12; XTP4
• Locus ID: 84299
• UniProt ID: Q9BRT3
• Cytogenetics: 17q12
• Summary: Increases cell migration by inducing filopodia formation at the leading edge of migrating cells. Plays a role in regulation of apoptosis, possibly through control of CASP3. May be involved in a redox-related process.[UniProtKB/Swiss-Prot Function]