ZNF323 (ZSCAN31) (NM_030899) Human Recombinant Protein

SKU
TP303342
Recombinant protein of human zinc finger protein 323 (ZNF323), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203342 protein sequence
Red=Cloning site Green=Tags(s)

MEHLGDSKLQRDVSLDSKYRETCKRDSKAEKQQAHSTGERRHRCNECGKSFTKSSVLIEHQRIHTGEKPY
ECEECGKAFSRRSSLNEHRRSHTGEKPYQCKECGKAFSASNGLTRHRRIHTGEKPYECKVCGKAFLLSSC
LVQHQRIHTGEKRYQCRECGKAFIQNAGLFQHLRVHTGEKPYQCSQCSKLFSKRTLLKKHQKIHTGERP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 24 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_112161
Locus ID 64288
UniProt ID Q96LW9
Cytogenetics 6p22.3-p22.1
RefSeq Size 3039
RefSeq ORF 627
Synonyms ZNF20-Lp; ZNF310P; ZNF323
Summary This gene encodes a protein containing multiple C2H2-type zinc finger motifs. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:ZNF323 (ZSCAN31) (NM_030899) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303342 ZNF323 MS Standard C13 and N15-labeled recombinant protein (NP_112161) 10 ug
$3,255.00
LC410670 ZSCAN31 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410670 Transient overexpression lysate of zinc finger protein 323 (ZNF323), transcript variant 1 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.