ZNF323 (ZSCAN31) Rabbit Polyclonal Antibody

SKU TA341411

Rabbit Polyclonal Anti-ZNF323 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF323 antibody: synthetic peptide directed towards the middle region of human ZNF323. Synthetic peptide located within the following region: QEILKEMEHLGDSKLQRDVSLDSKYRETCKRDSKAEKQQAHSTGERRHRC
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 47 kDa
• Gene Name: zinc finger and SCAN domain containing 31
• Database Link:
  NP_665916
  Q96LW9
• Background: ZNF323 is a member ofThe subfamily of C2H2 Kruppel-like zinc finger transcription factors that have a SCAN box domain (Pi et al., 2002 [PubMed 12147252]). [supplied by OMIM, Mar 2008]. Transcript Variant:This variant (1) encodes isoform 1. Variants 1, 4 and 7 encodeThe same protein. ##Evidence-Data-START## Transcript exon combination :: BC008490.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025082, ERS025083 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete onThe 3' end.
• Synonyms: dJ874C20.2; FLJ23407; ZNF20-Lp; ZNF310P
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transcription Factors