MAGP2 (MFAP5) (NM_003480) Human Recombinant Protein

SKU TP303242

Recombinant protein of human microfibrillar associated protein 5 (MFAP5), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203242 protein sequence; Red=Cloning site Green=Tags(s); ; MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTD; DLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELC; RQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 19.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_003471
• Locus ID: 8076
• UniProt ID: Q13361
• Cytogenetics: 12p13.31
• RefSeq Size: 2949
• RefSeq ORF: 519
• Synonyms: AAT9; MAGP-2; MAGP2; MFAP-5; MP25
• Summary: This gene encodes a 25-kD microfibril-associated glycoprotein which is a component of microfibrils of the extracellular matrix. The encoded protein promotes attachment of cells to microfibrils via alpha-V-beta-3 integrin. Deficiency of this gene in mice results in neutropenia. Alternate splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2014]
• Protein Families: Secreted Protein