MAGP2 (MFAP5) (NM_003480) Human Mass Spec Standard

SKU PH303242

MFAP5 MS Standard C13 and N15-labeled recombinant protein (NP_003471)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC203242]
• Predicted MW: 19.6 kDa
• Protein Sequence:
  Protein Sequence

  >RC203242 protein sequence; Red=Cloning site Green=Tags(s); ; MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTD; DLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELC; RQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_003471
• RefSeq Size: 2949
• RefSeq ORF: 519
• Synonyms: AAT9; MAGP-2; MAGP2; MFAP-5; MP25
• Locus ID: 8076
• UniProt ID: Q13361
• Cytogenetics: 12p13.31
• Summary: This gene encodes a 25-kD microfibril-associated glycoprotein which is a component of microfibrils of the extracellular matrix. The encoded protein promotes attachment of cells to microfibrils via alpha-V-beta-3 integrin. Deficiency of this gene in mice results in neutropenia. Alternate splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2014]
• Protein Families: Secreted Protein