TXNDC17 (NM_032731) Human Recombinant Protein

SKU TP303220

Recombinant protein of human thioredoxin domain containing 17 (TXNDC17), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203220 protein sequence; Red=Cloning site Green=Tags(s); ; MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQ; VGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSED; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 13.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_116120
• Locus ID: 84817
• UniProt ID: Q9BRA2
• Cytogenetics: 17p13.1
• RefSeq Size: 2075
• RefSeq ORF: 369
• Synonyms: TRP14; TXNL5
• Summary: Disulfide reductase. May participate in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyze dithiol-disulfide exchange reactions. Modulates TNF-alpha signaling and NF-kappa-B activation. Has peroxidase activity and may contribute to the elimination of cellular hydrogen peroxide.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome