TXNDC17 (NM_032731) Human Mass Spec Standard

SKU PH303220

TXNDC17 MS Standard C13 and N15-labeled recombinant protein (NP_116120)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC203220]
• Predicted MW: 13.9 kDa
• Protein Sequence:
  Protein Sequence

  >RC203220 protein sequence; Red=Cloning site Green=Tags(s); ; MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQ; VGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSED; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_116120
• RefSeq Size: 2075
• RefSeq ORF: 369
• Synonyms: TRP14; TXNL5
• Locus ID: 84817
• UniProt ID: Q9BRA2
• Cytogenetics: 17p13.1
• Summary: Disulfide reductase. May participate in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyze dithiol-disulfide exchange reactions. Modulates TNF-alpha signaling and NF-kappa-B activation. Has peroxidase activity and may contribute to the elimination of cellular hydrogen peroxide.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome