Cathepsin L (CTSL) (NM_001912) Human Recombinant Protein

SKU
TP303143
Recombinant protein of human cathepsin L1 (CTSL1), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203143 protein sequence
Red=Cloning site Green=Tags(s)

MNPTLILAAFCLGIASATLTFDHSLEAQWTKWKAMHNRLYGMNEEGWRRAVWEKNVKMIELHNQEYREGK
HSFTMAMNAFGDMTSEEFRQVMNGFQNRKPRKGKVFQEPLFYEAPRSVDWREKGYVTPVKNQGQCGSCWA
FSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEES
CKYNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLV
VGYGFESTESDNNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 35.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001903
Locus ID 1514
UniProt ID P07711
Cytogenetics 9q21.33
RefSeq Size 1730
RefSeq ORF 999
Synonyms CATL; CTSL1; MEP
Summary The protein encoded by this gene is a lysosomal cysteine proteinase that plays a major role in intracellular protein catabolism. Its substrates include collagen and elastin, as well as alpha-1 protease inhibitor, a major controlling element of neutrophil elastase activity. The encoded protein has been implicated in several pathologic processes, including myofibril necrosis in myopathies and in myocardial ischemia, and in the renal tubular response to proteinuria. This protein, which is a member of the peptidase C1 family, is a dimer composed of disulfide-linked heavy and light chains, both produced from a single protein precursor. Additionally, this protein cleaves the S1 subunit of the SARS-CoV-2 spike protein, which is necessary for entry of the virus into the cell. [provided by RefSeq, Aug 2020]
Protein Families Druggable Genome, Protease
Protein Pathways Antigen processing and presentation, Lysosome
Write Your Own Review
You're reviewing:Cathepsin L (CTSL) (NM_001912) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303143 CTSL1 MS Standard C13 and N15-labeled recombinant protein (NP_001903) 10 ug
$3,255.00
PH323541 CTSL1 MS Standard C13 and N15-labeled recombinant protein (NP_666023) 10 ug
$3,255.00
LC400711 CTSL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC407805 CTSL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400711 Transient overexpression lysate of cathepsin L1 (CTSL1), transcript variant 1 100 ug
$436.00
LY407805 Transient overexpression lysate of cathepsin L1 (CTSL1), transcript variant 2 100 ug
$436.00
TP323541 Recombinant protein of human cathepsin L1 (CTSL1), transcript variant 2, 20 µg 20 ug
$737.00
TP720657 Purified recombinant protein of Human cathepsin L1 (CTSL1), transcript variant 1 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.