Cathepsin L (CTSL) (NM_145918) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC223541] |
Predicted MW | 37.5 kDa |
Protein Sequence |
Protein Sequence
>RC223541 protein sequence
Red=Cloning site Green=Tags(s) MNPTLILAAFCLGIASATLTFDHSLEAQWTKWKAMHNRLYGMNEEGWRRAVWEKNVKMIELHNQEYREGK HSFTMAMNAFGDMTSEEFRQVMNGFQNRKPRKGKVFQEPLFYEAPRSVDWREKGYVTPVKNQGQCGSCWA FSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEES CKYNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLV VGYGFESTESDNNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_666023 |
RefSeq Size | 1587 |
RefSeq ORF | 999 |
Synonyms | CATL; CTSL1; MEP |
Locus ID | 1514 |
UniProt ID | P07711 |
Cytogenetics | 9q21.33 |
Summary | The protein encoded by this gene is a lysosomal cysteine proteinase that plays a major role in intracellular protein catabolism. Its substrates include collagen and elastin, as well as alpha-1 protease inhibitor, a major controlling element of neutrophil elastase activity. The encoded protein has been implicated in several pathologic processes, including myofibril necrosis in myopathies and in myocardial ischemia, and in the renal tubular response to proteinuria. This protein, which is a member of the peptidase C1 family, is a dimer composed of disulfide-linked heavy and light chains, both produced from a single protein precursor. Additionally, this protein cleaves the S1 subunit of the SARS-CoV-2 spike protein, which is necessary for entry of the virus into the cell. [provided by RefSeq, Aug 2020] |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Antigen processing and presentation, Lysosome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH303143 | CTSL1 MS Standard C13 and N15-labeled recombinant protein (NP_001903) | 10 ug |
$3,255.00
|
|
LC400711 | CTSL HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC407805 | CTSL HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400711 | Transient overexpression lysate of cathepsin L1 (CTSL1), transcript variant 1 | 100 ug |
$436.00
|
|
LY407805 | Transient overexpression lysate of cathepsin L1 (CTSL1), transcript variant 2 | 100 ug |
$436.00
|
|
TP303143 | Recombinant protein of human cathepsin L1 (CTSL1), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP323541 | Recombinant protein of human cathepsin L1 (CTSL1), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP720657 | Purified recombinant protein of Human cathepsin L1 (CTSL1), transcript variant 1 | 10 ug |
$330.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.