Myosin light chain 3 (MYL3) (NM_000258) Human Recombinant Protein

SKU
TP303122
Recombinant protein of human myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203122 protein sequence
Red=Cloning site Green=Tags(s)

MAPKKPEPKKDDAKAAPKAAPAPAPPPEPERPKEVEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMK
ITYGQCGDVLRALGQNPTQAEVLRVLGKPRQEELNTKMMDFETFLPMLQHISKNKDTGTYEDFVEGLRVF
DKEGNGTVMGAELRHVLATLGERLTEDEVEKLMAGQEDSNGCINYEAFVKHIMSS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 21.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000249
Locus ID 4634
UniProt ID P08590
Cytogenetics 3p21.31
RefSeq Size 942
RefSeq ORF 585
Synonyms CMH8; MLC-lV/sb; MLC1SB; MLC1V; VLC1; VLCl
Summary MYL3 encodes myosin light chain 3, an alkali light chain also referred to in the literature as both the ventricular isoform and the slow skeletal muscle isoform. Mutations in MYL3 have been identified as a cause of mid-left ventricular chamber type hypertrophic cardiomyopathy. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM)
Write Your Own Review
You're reviewing:Myosin light chain 3 (MYL3) (NM_000258) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303122 MYL3 MS Standard C13 and N15-labeled recombinant protein (NP_000249) 10 ug
$3,255.00
LC400098 MYL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400098 Transient overexpression lysate of myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.