Myosin light chain 3 (MYL3) (NM_000258) Human Tagged ORF Clone

SKU
RC203122
MYL3 (Myc-DDK-tagged)-Human myosin, light chain 3, alkali, ventricular, skeletal, slow (MYL3)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Myosin light chain 3
Synonyms CMH8; MLC-lV/sb; MLC1SB; MLC1V; VLC1; VLCl
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203122 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCCCAAAAAGCCAGAGCCCAAGAAGGATGATGCCAAGGCAGCCCCCAAGGCAGCTCCAGCTCCCG
CACCTCCCCCTGAGCCTGAGCGCCCTAAGGAGGTCGAGTTTGATGCTTCCAAGATCAAGATTGAGTTCAC
ACCTGAGCAGATTGAAGAGTTCAAGGAAGCCTTCATGCTGTTCGACCGCACACCCAAGTGTGAGATGAAG
ATCACCTACGGGCAGTGTGGGGATGTCCTGCGGGCGCTGGGCCAGAACCCCACACAGGCAGAAGTGCTCC
GTGTCCTGGGGAAGCCAAGACAGGAAGAGCTCAATACCAAGATGATGGACTTTGAAACTTTCCTGCCTAT
GCTCCAGCACATTTCCAAGAACAAGGACACAGGCACCTATGAGGACTTCGTGGAGGGGCTGCGGGTCTTC
GACAAGGAGGGCAATGGCACTGTCATGGGTGCTGAGCTTCGCCACGTGCTGGCCACGCTGGGTGAGAGGC
TGACAGAAGACGAAGTGGAGAAGTTGATGGCTGGGCAAGAGGACTCCAATGGCTGCATCAACTATGAAGC
ATTTGTGAAGCACATCATGTCCAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203122 protein sequence
Red=Cloning site Green=Tags(s)

MAPKKPEPKKDDAKAAPKAAPAPAPPPEPERPKEVEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMK
ITYGQCGDVLRALGQNPTQAEVLRVLGKPRQEELNTKMMDFETFLPMLQHISKNKDTGTYEDFVEGLRVF
DKEGNGTVMGAELRHVLATLGERLTEDEVEKLMAGQEDSNGCINYEAFVKHIMSS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_000258
ORF Size 585 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000258.3
RefSeq Size 942 bp
RefSeq ORF 588 bp
Locus ID 4634
UniProt ID P08590
Cytogenetics 3p21.31
Protein Families Druggable Genome
Protein Pathways Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM)
MW 21.9 kDa
Summary MYL3 encodes myosin light chain 3, an alkali light chain also referred to in the literature as both the ventricular isoform and the slow skeletal muscle isoform. Mutations in MYL3 have been identified as a cause of mid-left ventricular chamber type hypertrophic cardiomyopathy. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Myosin light chain 3 (MYL3) (NM_000258) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203122L1 Lenti ORF clone of Human myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3), Myc-DDK-tagged 10 ug
$750.00
RC203122L2 Lenti ORF clone of Human myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3), mGFP tagged 10 ug
$750.00
RC203122L3 Lenti ORF clone of Human myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3), Myc-DDK-tagged 10 ug
$750.00
RC203122L4 Lenti ORF clone of Human myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3), mGFP tagged 10 ug
$750.00
RG203122 MYL3 (tGFP-tagged) - Human myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3) 10 ug
$650.00
SC122554 MYL3 (untagged)-Human myosin, light chain 3, alkali, ventricular, skeletal, slow (MYL3) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.