HSD11B1 (NM_005525) Human Recombinant Protein

SKU
TP303109
Recombinant protein of human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203109 protein sequence
Red=Cloning site Green=Tags(s)

MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKET
LQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSM
EVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSI
TLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLY
STSYNMDRFINK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 32.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_005516
Locus ID 3290
UniProt ID P28845
Cytogenetics 1q32.2
RefSeq Size 1477
RefSeq ORF 876
Synonyms 11-beta-HSD1; 11-DH; CORTRD2; HDL; HSD11; HSD11B; HSD11L; SDR26C1
Summary The protein encoded by this gene is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, the encoded protein can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. Mutations in this gene and H6PD (hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)) are the cause of cortisone reductase deficiency. Alternate splicing results in multiple transcript variants encoding the same protein.[provided by RefSeq, May 2011]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Androgen and estrogen metabolism, C21-Steroid hormone metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:HSD11B1 (NM_005525) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303109 HSD11B1 MS Standard C13 and N15-labeled recombinant protein (NP_005516) 10 ug
$3,255.00
PH312093 HSD11B1 MS Standard C13 and N15-labeled recombinant protein (NP_861420) 10 ug
$3,255.00
LC401695 HSD11B1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405624 HSD11B1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401695 Transient overexpression lysate of hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 1 100 ug
$436.00
LY405624 Transient overexpression lysate of hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 2 100 ug
$436.00
TP312093 Recombinant protein of human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 2, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.