OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HSD11B1 (NM_181755) Human Mass Spec Standard

Be the first to review this product
SKU
PH312093
HSD11B1 MS Standard C13 and N15-labeled recombinant protein (NP_861420)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY401695 Transient overexpression lysate of hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "HSD11B1 or NM_181755"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC212093
Predicted MW 32.4 kDa
Protein Sequence
Protein Sequence
>RC212093 protein sequence
Red=Cloning site Green=Tags(s)

MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKET
LQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSM
EVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSI
TLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLY
STSYNMDRFINK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_861420
RefSeq Size 1457
RefSeq ORF 876
Synonyms 11-beta-HSD1; 11-DH; CORTRD2; HDL; HSD11; HSD11B; HSD11L; SDR26C1
Locus ID 3290
UniProt ID P28845
Cytogenetics 1q32.2
Summary The protein encoded by this gene is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, the encoded protein can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. Mutations in this gene and H6PD (hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)) are the cause of cortisone reductase deficiency. Alternate splicing results in multiple transcript variants encoding the same protein.provided by RefSeq, May 2011
Protein Families Druggable Genome, Transmembrane
Protein Pathways Androgen and estrogen metabolism, C21-Steroid hormone metabolism, Metabolic pathways
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HSD11B1" proteins (7)
SKU Description Size Price
PH303109 HSD11B1 MS Standard C13 and N15-labeled recombinant protein (NP_005516) 10 ug
$3,360.00
LC401695 Lyophilized HSD11B1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405624 Lyophilized HSD11B1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401695 Transient overexpression lysate of hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY405624 Transient overexpression lysate of hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP303109 Recombinant protein of human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 1, 20 µg 20 ug
$867.00
TP312093 Recombinant protein of human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products