HSD11B1 (NM_181755) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC212093] |
Predicted MW | 32.4 kDa |
Protein Sequence |
Protein Sequence
>RC212093 protein sequence
Red=Cloning site Green=Tags(s) MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKET LQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSM EVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSI TLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLY STSYNMDRFINK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_861420 |
RefSeq Size | 1457 |
RefSeq ORF | 876 |
Synonyms | 11-beta-HSD1; 11-DH; CORTRD2; HDL; HSD11; HSD11B; HSD11L; SDR26C1 |
Locus ID | 3290 |
UniProt ID | P28845 |
Cytogenetics | 1q32.2 |
Summary | The protein encoded by this gene is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, the encoded protein can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. Mutations in this gene and H6PD (hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)) are the cause of cortisone reductase deficiency. Alternate splicing results in multiple transcript variants encoding the same protein.[provided by RefSeq, May 2011] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Androgen and estrogen metabolism, C21-Steroid hormone metabolism, Metabolic pathways |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH303109 | HSD11B1 MS Standard C13 and N15-labeled recombinant protein (NP_005516) | 10 ug |
$3,255.00
|
|
LC401695 | HSD11B1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC405624 | HSD11B1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY401695 | Transient overexpression lysate of hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 1 | 100 ug |
$436.00
|
|
LY405624 | Transient overexpression lysate of hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 2 | 100 ug |
$436.00
|
|
TP303109 | Recombinant protein of human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 1, 20 µg | 20 ug |
$867.00
|
|
TP312093 | Recombinant protein of human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 2, 20 µg | 20 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.