FXC1 (TIMM10B) (NM_012192) Human Recombinant Protein

SKU
TP303083
Recombinant protein of human fracture callus 1 homolog (rat) (FXC1), nuclear gene encoding mitochondrial protein, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203083 protein sequence
Red=Cloning site Green=Tags(s)

MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQL
MPALVQRRIADYEAASAVPSVAAEQPGVSPSGS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 11.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_036324
Locus ID 26515
UniProt ID Q9Y5J6
Cytogenetics 11p15.4
RefSeq Size 2861
RefSeq ORF 309
Synonyms FXC1; Tim9b; TIM10B
Summary FXC1, or TIMM10B, belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane.[supplied by OMIM, Apr 2004]
Write Your Own Review
You're reviewing:FXC1 (TIMM10B) (NM_012192) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303083 FXC1 MS Standard C13 and N15-labeled recombinant protein (NP_036324) 10 ug
$3,255.00
LC415921 TIMM10B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415921 Transient overexpression lysate of fracture callus 1 homolog (rat) (FXC1), nuclear gene encoding mitochondrial protein 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.