FXC1 (TIMM10B) (NM_012192) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC203083] |
Predicted MW | 11.6 kDa |
Protein Sequence |
Protein Sequence
>RC203083 protein sequence
Red=Cloning site Green=Tags(s) MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQL MPALVQRRIADYEAASAVPSVAAEQPGVSPSGS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_036324 |
RefSeq Size | 2861 |
RefSeq ORF | 309 |
Synonyms | FXC1; Tim9b; TIM10B |
Locus ID | 26515 |
UniProt ID | Q9Y5J6 |
Cytogenetics | 11p15.4 |
Summary | FXC1, or TIMM10B, belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane.[supplied by OMIM, Apr 2004] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC415921 | TIMM10B HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY415921 | Transient overexpression lysate of fracture callus 1 homolog (rat) (FXC1), nuclear gene encoding mitochondrial protein | 100 ug |
$436.00
|
|
TP303083 | Recombinant protein of human fracture callus 1 homolog (rat) (FXC1), nuclear gene encoding mitochondrial protein, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.