IRAK4 (NM_016123) Human Recombinant Protein

SKU
TP303041
Recombinant protein of human interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203041 protein sequence
Red=Cloning site Green=Tags(s)

MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTSEL
LFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITVQQKQMPFCDKDRTLMTPVQN
LEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTV
AVKKLAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGT
PPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVG
TTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMND
ADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 51.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_057207
Locus ID 51135
UniProt ID Q9NWZ3
Cytogenetics 12q12
RefSeq Size 4303
RefSeq ORF 1380
Synonyms IMD67; IPD1; IRAK-4; NY-REN-64; REN64
Summary This gene encodes a kinase that activates NF-kappaB in both the Toll-like receptor (TLR) and T-cell receptor (TCR) signaling pathways. The protein is essential for most innate immune responses. Mutations in this gene result in IRAK4 deficiency and recurrent invasive pneumococcal disease. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Apoptosis, Neurotrophin signaling pathway, Toll-like receptor signaling pathway
Write Your Own Review
You're reviewing:IRAK4 (NM_016123) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303041 IRAK4 MS Standard C13 and N15-labeled recombinant protein (NP_057207) 10 ug
$3,255.00
LC402503 IRAK4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426473 IRAK4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402503 Transient overexpression lysate of interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 2 100 ug
$436.00
LY426473 Transient overexpression lysate of interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 1 100 ug
$436.00
TP761970 Purified recombinant protein of Human interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 1,full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.