IRAK4 (NM_016123) Human Mass Spec Standard

SKU
PH303041
IRAK4 MS Standard C13 and N15-labeled recombinant protein (NP_057207)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203041]
Predicted MW 51.5 kDa
Protein Sequence
Protein Sequence
>RC203041 protein sequence
Red=Cloning site Green=Tags(s)

MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTSEL
LFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITVQQKQMPFCDKDRTLMTPVQN
LEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTV
AVKKLAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGT
PPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVG
TTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMND
ADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057207
RefSeq Size 4303
RefSeq ORF 1380
Synonyms IMD67; IPD1; IRAK-4; NY-REN-64; REN64
Locus ID 51135
UniProt ID Q9NWZ3
Cytogenetics 12q12
Summary This gene encodes a kinase that activates NF-kappaB in both the Toll-like receptor (TLR) and T-cell receptor (TCR) signaling pathways. The protein is essential for most innate immune responses. Mutations in this gene result in IRAK4 deficiency and recurrent invasive pneumococcal disease. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Apoptosis, Neurotrophin signaling pathway, Toll-like receptor signaling pathway
Write Your Own Review
You're reviewing:IRAK4 (NM_016123) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402503 IRAK4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426473 IRAK4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402503 Transient overexpression lysate of interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 2 100 ug
$436.00
LY426473 Transient overexpression lysate of interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 1 100 ug
$436.00
TP303041 Recombinant protein of human interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 2, 20 µg 20 ug
$737.00
TP761970 Purified recombinant protein of Human interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 1,full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.