WIBG (PYM1) (NM_032345) Human Recombinant Protein

SKU
TP302988
Recombinant protein of human within bgcn homolog (Drosophila) (WIBG), transcript variant 1, 20 µg
  $737.00
4 Weeks*
Specifications
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202988 protein sequence
Red=Cloning site Green=Tags(s)

MEAAGSPAATETGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELPPGLSPEATAP
VTPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEETAQLPSAPQGSRAAPTAASD
QPDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPSKEQLEKLARRRALEEELEDLELGL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 22.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_115721
Locus ID 84305
UniProt ID Q9BRP8
Cytogenetics 12q13.2
RefSeq Size 1244
RefSeq ORF 612
Synonyms PYM; WIBG
Summary Key regulator of the exon junction complex (EJC), a multiprotein complex that associates immediately upstream of the exon-exon junction on mRNAs and serves as a positional landmark for the intron exon structure of genes and directs post-transcriptional processes in the cytoplasm such as mRNA export, nonsense-mediated mRNA decay (NMD) or translation. Acts as an EJC disassembly factor, allowing translation-dependent EJC removal and recycling by disrupting mature EJC from spliced mRNAs. Its association with the 40S ribosomal subunit probably prevents a translation-independent disassembly of the EJC from spliced mRNAs, by restricting its activity to mRNAs that have been translated. Interferes with NMD and enhances translation of spliced mRNAs, probably by antagonizing EJC functions. May bind RNA; the relevance of RNA-binding remains unclear in vivo, RNA-binding was detected by PubMed:14968132, while PubMed:19410547 did not detect RNA-binding activity independently of the EJC.[UniProtKB/Swiss-Prot Function]
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "91939" proteins (8)
SKU Description Size Price
PH302988 WIBG MS Standard C13 and N15-labeled recombinant protein (NP_115721) 10 ug
$3,255.00
PH327106 WIBG MS Standard C13 and N15-labeled recombinant protein (NP_001137325) 10 ug
$3,255.00
LC410182 WIBG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428389 WIBG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410182 Transient overexpression lysate of within bgcn homolog (Drosophila) (WIBG), transcript variant 1 100 ug
$436.00
LY428389 Transient overexpression lysate of within bgcn homolog (Drosophila) (WIBG), transcript variant 2 100 ug
$436.00
TP327106 Recombinant protein of human within bgcn homolog (Drosophila) (WIBG), transcript variant 2, 20 µg 20 ug
$737.00
TP720529 Recombinant protein of human within bgcn homolog (Drosophila) (WIBG), transcript variant 2 10 ug
$330.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.