WIBG (PYM1) (NM_032345) Human Mass Spec Standard

SKU
PH302988
WIBG MS Standard C13 and N15-labeled recombinant protein (NP_115721)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202988]
Predicted MW 22.7 kDa
Protein Sequence
Protein Sequence
>RC202988 protein sequence
Red=Cloning site Green=Tags(s)

MEAAGSPAATETGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELPPGLSPEATAP
VTPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEETAQLPSAPQGSRAAPTAASD
QPDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPSKEQLEKLARRRALEEELEDLELGL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115721
RefSeq Size 1244
RefSeq ORF 612
Synonyms PYM; WIBG
Locus ID 84305
UniProt ID Q9BRP8
Cytogenetics 12q13.2
Summary Key regulator of the exon junction complex (EJC), a multiprotein complex that associates immediately upstream of the exon-exon junction on mRNAs and serves as a positional landmark for the intron exon structure of genes and directs post-transcriptional processes in the cytoplasm such as mRNA export, nonsense-mediated mRNA decay (NMD) or translation. Acts as an EJC disassembly factor, allowing translation-dependent EJC removal and recycling by disrupting mature EJC from spliced mRNAs. Its association with the 40S ribosomal subunit probably prevents a translation-independent disassembly of the EJC from spliced mRNAs, by restricting its activity to mRNAs that have been translated. Interferes with NMD and enhances translation of spliced mRNAs, probably by antagonizing EJC functions. May bind RNA; the relevance of RNA-binding remains unclear in vivo, RNA-binding was detected by PubMed:14968132, while PubMed:19410547 did not detect RNA-binding activity independently of the EJC.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:WIBG (PYM1) (NM_032345) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH327106 WIBG MS Standard C13 and N15-labeled recombinant protein (NP_001137325) 10 ug
$3,255.00
LC410182 WIBG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428389 WIBG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410182 Transient overexpression lysate of within bgcn homolog (Drosophila) (WIBG), transcript variant 1 100 ug
$436.00
LY428389 Transient overexpression lysate of within bgcn homolog (Drosophila) (WIBG), transcript variant 2 100 ug
$436.00
TP302988 Recombinant protein of human within bgcn homolog (Drosophila) (WIBG), transcript variant 1, 20 µg 20 ug
$737.00
TP327106 Recombinant protein of human within bgcn homolog (Drosophila) (WIBG), transcript variant 2, 20 µg 20 ug
$737.00
TP720529 Recombinant protein of human within bgcn homolog (Drosophila) (WIBG), transcript variant 2 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.