CD69 (NM_001781) Human Recombinant Protein

SKU
TP302756
Recombinant protein of human CD69 molecule (CD69), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202756 protein sequence
Red=Cloning site Green=Tags(s)

MSSENCFVAENSSLHPESGQENDATSPHFSTRHEGSFQVPVLCAVMNVVFITILIIALIALSVGQYNCPG
QYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREE
HWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 22.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001772
Locus ID 969
UniProt ID Q07108
Cytogenetics 12p13.31
RefSeq Size 1676
RefSeq ORF 597
Synonyms AIM; BL-AC/P26; CLEC2C; EA1; GP32/28; MLR-3
Summary This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may act to transmit signals in natural killer cells and platelets. [provided by RefSeq, Aug 2011]
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Write Your Own Review
You're reviewing:CD69 (NM_001781) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302756 CD69 MS Standard C13 and N15-labeled recombinant protein (NP_001772) 10 ug
$3,255.00
LC400672 CD69 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400672 Transient overexpression lysate of CD69 molecule (CD69), transcript variant 1 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.