CD69 (NM_001781) Human Mass Spec Standard

SKU PH302756

CD69 MS Standard C13 and N15-labeled recombinant protein (NP_001772)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC202756]
• Predicted MW: 22.6 kDa
• Protein Sequence:
  Protein Sequence

  >RC202756 protein sequence; Red=Cloning site Green=Tags(s); ; MSSENCFVAENSSLHPESGQENDATSPHFSTRHEGSFQVPVLCAVMNVVFITILIIALIALSVGQYNCPG; QYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREE; HWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001772
• RefSeq Size: 1676
• RefSeq ORF: 597
• Synonyms: AIM; BL-AC/P26; CLEC2C; EA1; GP32/28; MLR-3
• Locus ID: 969
• UniProt ID: Q07108
• Cytogenetics: 12p13.31
• Summary: This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may act to transmit signals in natural killer cells and platelets. [provided by RefSeq, Aug 2011]
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Transmembrane