SERPINB3 (NM_006919) Human Recombinant Protein
SKU
TP302683
Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 3 (SERPINB3), 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC202683 protein sequence
Red=Cloning site Green=Tags(s) MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKA ATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAP EESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSI QMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRV DLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVV GFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.4 kDa |
Concentration | >0.1 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_008850 |
Locus ID | 6317 |
UniProt ID | P29508 |
Cytogenetics | 18q21.33 |
RefSeq Size | 1793 |
RefSeq ORF | 1170 |
Synonyms | HsT1196; SCC; SCCA-1; SCCA-PD; SCCA1; SSCA1; T4-A |
Summary | May act as a papain-like cysteine protease inhibitor to modulate the host immune response against tumor cells. Also functions as an inhibitor of UV-induced apoptosis via suppression of the activity of c-Jun NH(2)-terminal kinase (JNK1).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Secreted Protein |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH302683 | SERPINB3 MS Standard C13 and N15-labeled recombinant protein (NP_008850) | 10 ug |
$3,255.00
|
|
LC416321 | SERPINB3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY416321 | Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 3 (SERPINB3) | 100 ug |
$436.00
|
|
TP790063 | Purified recombinant protein of Human serpin peptidase inhibitor, clade B (ovalbumin), member 3 (SERPINB3), with N-terminal HIS tag, expressed in HEK293, 50ug | 50 ug |
$515.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.