SERPINB3 (NM_006919) Human Mass Spec Standard

SKU
PH302683
SERPINB3 MS Standard C13 and N15-labeled recombinant protein (NP_008850)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202683]
Predicted MW 44.6 kDa
Protein Sequence
Protein Sequence
>RC202683 protein sequence
Red=Cloning site Green=Tags(s)

MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKA
ATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAP
EESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSI
QMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRV
DLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVV
GFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_008850
RefSeq Size 1793
RefSeq ORF 1170
Synonyms HsT1196; SCC; SCCA-1; SCCA-PD; SCCA1; SSCA1; T4-A
Locus ID 6317
UniProt ID P29508
Cytogenetics 18q21.33
Summary May act as a papain-like cysteine protease inhibitor to modulate the host immune response against tumor cells. Also functions as an inhibitor of UV-induced apoptosis via suppression of the activity of c-Jun NH(2)-terminal kinase (JNK1).[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome, Secreted Protein
Write Your Own Review
You're reviewing:SERPINB3 (NM_006919) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416321 SERPINB3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416321 Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 3 (SERPINB3) 100 ug
$436.00
TP302683 Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 3 (SERPINB3), 20 µg 20 ug
$737.00
TP790063 Purified recombinant protein of Human serpin peptidase inhibitor, clade B (ovalbumin), member 3 (SERPINB3), with N-terminal HIS tag, expressed in HEK293, 50ug 50 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.