CHCHD5 (NM_032309) Human Recombinant Protein

  • MVPro

    Full-length human proteins expressed in HEK293T cells

SKU
TP302606
Recombinant protein of human coiled-coil-helix-coiled-coil-helix domain containing 5 (CHCHD5), 20 µg
$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202606 protein sequence
Red=Cloning site Green=Tags(s)

MQAALEVTARYCGRELEQYGQCVAAKPESWQRDCHYLKMSIAQCTSSHPIIRQIRQACAQPFEAFEECLR
QNEAAVGNCAEHMRRFLQCAEQVQPPRSPATVEAQPLPAS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 12.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_115685
Locus ID 84269
UniProt ID Q9BSY4
Cytogenetics 2q14.1
RefSeq Size 698
RefSeq ORF 330
Synonyms C2orf9; CHTM1; MIC14; MIX14
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

SKU Description Size Price
PH302606 CHCHD5 MS Standard C13 and N15-labeled recombinant protein (NP_115685) 10 ug
$3,255.00
LC410209 CHCHD5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410209 Transient overexpression lysate of coiled-coil-helix-coiled-coil-helix domain containing 5 (CHCHD5) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.