CHCHD5 (NM_032309) Human Mass Spec Standard

SKU
PH302606
CHCHD5 MS Standard C13 and N15-labeled recombinant protein (NP_115685)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202606]
Predicted MW 12.4 kDa
Protein Sequence
Protein Sequence
>RC202606 protein sequence
Red=Cloning site Green=Tags(s)

MQAALEVTARYCGRELEQYGQCVAAKPESWQRDCHYLKMSIAQCTSSHPIIRQIRQACAQPFEAFEECLR
QNEAAVGNCAEHMRRFLQCAEQVQPPRSPATVEAQPLPAS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115685
RefSeq Size 698
RefSeq ORF 330
Synonyms C2orf9; CHTM1; MIC14; MIX14
Locus ID 84269
UniProt ID Q9BSY4
Cytogenetics 2q14.1
Write Your Own Review
You're reviewing:CHCHD5 (NM_032309) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410209 CHCHD5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410209 Transient overexpression lysate of coiled-coil-helix-coiled-coil-helix domain containing 5 (CHCHD5) 100 ug
$436.00
TP302606 Recombinant protein of human coiled-coil-helix-coiled-coil-helix domain containing 5 (CHCHD5), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.